- Proteasome 20S alpha 5 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86837
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Unconjugated
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: ARVETQNHWF TYNETMTVES VTQAVSNLAL QFGEEDADPG AMSRPFGVAL LFGGVDEKGP QLFHMDPSGT FVQCD
- PSC5, ZETA
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Proteasome 20S alpha 5
- proteasome 20S subunit alpha 5
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Core ESC Like Genes, Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCD
Specifications/Features
Available conjugates: Unconjugated